重组人小泛素相关修饰2(Recombinant Human SUMO2)

SUMO2 Human
Small Ubiquitin-Related Modifier 2 Human Recombinant
Catalog No. PRO-586

Synonyms:
SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2
HSMT3, SUMO-3, Sentrin2, SUMO2, SMT3H2, MGC117191.

Introduction:
Small Ubiquitin-like Modifiers (SUMOs) are a family of small, related proteins that can be enzymatically attached to a target protein by a post-translational modification process termed sumoylation. Unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. All SUMO proteins share the conserved ubiquitin domain and the C-terminal diglycine cleavage/attachment site. Human SUMO2, also known as Sentrin2 and SMT3B is synthesized as a 95 amino acid (aa), 11 kDa propeptide that contains a two aa C-terminal prosegment, and an 18 aa N-terminal protein interacting region (aa 33 -50). Following prosegment cleavage, the C-terminal glycine is enzymatically attached to a lysine on a target protein. Human SUMO2 shares 100% sequence identity to SUMO-2 from mouse. SUMO2 also has very high sequence homology to SUMO3 and SUMO4, 86 % and 85%, respectively. SUMO2 shares only 44% sequence identity to SUMO1.

Description:
SUMO2 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 95 amino acids and having a molecular mass of 11 kDa.
The SUMO-2 is purified by proprietary chromatographic techniques.

Source:
Escherichia Coli.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Formulation:
The SUMO2 was lyophiized from 1X PBS, pH 7.4.

Stability:
Lyophilized SUMO2 although stable 10°C for 1 week, should be stored desiccated below -18°C.
Please prevent freeze-thaw cycles.

Purity:
Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Amino Acid Sequence:
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC
ERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY.

Usage:
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Related Products

» SUMO1 Human
» SUMO2 Human, GST Tag